StudyVedanta
Skip to the verse
V.818.718.9
Read slowly

Setting a duty down from fear of bodily strain is a counterfeit of renunciation, and it bears no fruit.

It is tempting to call any stepping-back from hard work a kind of letting-go. Krishna is exact here: the giving-up that flees discomfort is not the giving-up that frees you, and it grants nothing at all.

8Chapter 18
The verseSpoken by Krishna
Voices5 commentators · 5 schools · modern voices
The readingAbout 5 minutes, unhurried
दुःखमित्येव यत्कर्म कायक्लेशभयात्त्यजेत्।स कृत्वा राजसं त्यागं नैव त्यागफलं लभेत्
duḥkham ity eva yat karma kāya-kleśha-bhayāt tyajet sa kṛitvā rājasaṁ tyāgaṁ naiva tyāga-phalaṁ labhet

Whoever gives up a duty simply because it is unpleasant, out of fear of the strain it puts on the body, has practiced a rajasic renunciation. That renunciation bears no fruit at all.

Bhagavad Gita 18.8
0:00 / 0:00

Saved for this reading session

Three movements · tap a label to switch

Sanskrit recitation by Swami Brahmānanda

Audio from the Gītā Supersite, IIT Kanpur

The reading read whole, as one unhurried piece

Where it stands

Krishna has just named the lowest kind of giving-up, the dull, tamasic kind, where a person simply never sees the work as a duty at all. Now he moves one step up, to a subtler failure: the renunciation of someone who does see the duty clearly, but drops it anyway because it hurts.

The teaching

Fleeing a duty from bodily fear is a counterfeit of letting-go, and it grants nothing.

There is a renunciation that looks, from the outside, like real letting-go, and is not. A person regards a piece of obligatory work, judges it as nothing but trouble, and sets it down purely from fear of the strain it will cost the body. Krishna calls this rajasic, because the very motive behind it, pain and the restless aversion to discomfort, belongs to rajas, and the act of giving-up takes its color from that motive rather than from the work itself. The result is stated flatly: such a person gains no fruit of relinquishment at all. The looking-like of renunciation is there; the substance is not, because the duty was abandoned for the wrong reason. This is not the same error as the tamasic case just before it. There, the person is simply blind to the duty. Here, at least on the reading that dwells longest on this point, the person may see the duty with full clarity, know it is his to do, and begin it, only to flee at the first real discomfort, the way one drops something too hot to hold. Two of the acaryas ordinarily gathered on this page are honestly silent or near-silent on this particular line, and rather than invent what they might have said, this reading marks the silence and moves on with what the remaining sources actually give.

The doubt that rises

If a task truly exhausts or endangers the body, is stepping back from it always this same failure, or is there a real difference between fear-driven flight and honest, necessary rest, and if so, where exactly does the line fall?

Where the paths divide

Advaita Vedanta

Read against the triad of tamasic, rajasic, and sattvic giving-up.

This renunciation is a counterfeit, set against the true, sattvic giving-up the next verse will describe. What is forfeited is the fruit that real renunciation carries: freedom, reached by resting in knowledge once action has genuinely, not merely outwardly, been laid down. The rajasic renouncer has avoided discomfort and mistaken the avoidance for the deeper letting-go still to come.

Vishishtadvaita

Read as a misreading of scripture built to excuse a fear of toil.

Here the failure is doctrinal before it is emotional. Seeing that action toward liberation demands painful toil, the person concludes that knowledge alone should be pursued, and abandons the great sacrifices and duties of his station on that reasoning. But the mind's serenity is never produced by toil alone; it comes only through the grace of the Lord. To flee action, thinking effort by itself can do grace's work, is to misunderstand how liberation actually arrives.

Dvaita

An honest gap in the record.

No comment by Madhva on this verse survives among the sources available here. Rather than construct a Dvaita reading in his name, this space is left as what it is: silence. What can be said only as background, not as his stated word on 18.8, is that his wider Gita commentary treats every capacity to act or renounce as delegated by the Lord, never self-owned.

Kashmir Shaivism

A block comment, not a verse-specific one, with any extension flagged as such.

Abhinavagupta's surviving remarks on this stretch of the text treat verses 18.4 through 18.11 together, sitting at 18.4 rather than here. There he holds that giving-up takes the color of whichever guna moves it, so rajasic or tamasic renunciation yields no fruit, while only the even-minded, sattvic renouncer gains one. Applying this specifically to bodily fear, as this verse describes, is offered here only as a conditional extension of that general principle, not as his stated comment on 18.8.

Bhakti

Read through the sharpest image among the available sources.

The deepest failure is not knowing that the self is no doer; not seeing this, the person judges steady work as mere pain and drops it from bodily fear. The image offered is exact: such fear-driven abandonment is an evil counterfeit of real letting-go, no truer than an accidental fall into water is a holy immersion. Only the dawn of Self-knowledge, swallowing all action and ignorance as morning light swallows the stars, is renunciation in truth, and only that bears fruit.

Modern

Read as a practical, self-examinable test.

Set aside doctrine for a moment and take this as a test you can run on yourself. The question this verse leaves you with is never whether a task is difficult, but whether you set it down because it is genuinely not yours to carry, or only because it is uncomfortable. If the honest answer is the second, what happened was not letting-go at all, only avoidance wearing its clothes.

All the available sources agree on the shape of the failure and on the flat verdict that no fruit follows it. They part, where they speak at all, on exactly what is lost and why: a forfeited standing in knowledge, a misreading of how grace and toil relate, or a deeper blindness to the self's true nature. Two of the six acaryas ordinarily gathered here, Madhva and Abhinavagupta, have little or nothing verse-specific to add, and that gap is left open rather than closed by invention.

A question to carry

The last time you set a duty down, was it because it truly was not yours to carry, or because you let your body's discomfort become the deciding voice?

So when the next duty grows heavy in your hands, pause before you name your retreat a letting-go. Ask what is actually deciding for you, and let only the honest answer, not the relief of stopping, tell you what you have really done.

Each school is voiced from the commentators named above. Their full words, every translation, and where the schools agree and differ wait in the reading desk just below. Open the commentary desk.

Having just described the lowest, tamasic form of giving-up in the verse before, Krishna now marks out this middling, rajasic form, before turning next to the sattvic renunciation that alone bears fruit.

Where they agreethe convergence

When work is set down only because it is painful, out of fear of bodily strain, that giving-up is rajasic, and the sources agree it grants no fruit of true renunciation.

Across schools and centuries the commentators come to the same ground. These are the points they share, and the voices that hold each one.

3schools

The mark of this failure is a motive, not an activity: the duty is dropped only because it is unpleasant and the body fears the strain of it.

Across Advaita, Viśiṣṭādvaita, BhaktiŚaṅkara · Rāmānuja · Śrīdhara · Madhusūdana
In Śaṅkara, Rāmānuja, and 2 others’ words

This verse names the second, middling kind of renunciation, rajasic tyaga, coming right after the tamasic giving-up of the verse before it. The mark of it is simple: a person drops a duty only because it is painful, out of fear of the strain it will put on the body.

Asked in question 1, below
3schools

The act takes its color from that motive, since pain and the flinching from discomfort are themselves qualities of rajas.

Across Advaita, Viśiṣṭādvaita, BhaktiŚaṅkara · Rāmānuja · Śrīdhara · Madhusūdana
In Śaṅkara, Rāmānuja, and 2 others’ words

The renunciation is classed as rajasic because its very cause is rajas. Pain, and the restless aversion to discomfort, are themselves qualities of rajas, so the giving-up born from them takes on that same coloring, whatever the actual content of the duty being dropped.

Asked in question 3, below
2schools

What is set down here is real, obligatory duty, not some private indulgence, which is exactly what makes the abandonment go wrong.

Across Advaita, BhaktiŚaṅkara · Śrīdhara · Madhusūdana
In Śaṅkara, Śrīdhara, and 1 others’ words

What is renounced here is not some private indulgence but obligatory work, the duty one is actually meant to be doing. Setting that duty down merely to spare the body its discomfort is precisely what makes the renunciation go wrong.

3schools

The outward look of giving-up is present, but the result is stated without softening: no fruit of relinquishment comes at all.

Across Advaita, Viśiṣṭādvaita, BhaktiŚaṅkara · Rāmānuja · Śrīdhara
In Śaṅkara, Rāmānuja, and 1 others’ words

The consequence is stated without softening: such a person gains no fruit of renunciation at all. The outward appearance of letting go is present, but whatever renunciation was supposed to ripen into never arrives, because the duty was abandoned for the wrong reason.

Asked in question 2, below
2schools

Two sources on this verse's own roster are honestly thin or absent, Madhva and Abhinavagupta, and the gap is kept visible rather than filled with invented words.

Across Bhakti, AdvaitaŚrīdhara · Madhusūdana
In Śrīdhara and Madhusūdana’s words

This is not the same failure as the tamasic renunciation named just before it. There, the person never even recognizes the work as a duty. Here, at least on Sridhara's reading, the person may know quite clearly that the duty is his and that he is capable of it, yet he still lets the body's comfort outweigh that knowledge.

This is the shared ground; it can be carried as it is. Below is where they differ.

Where they differthe divergence

The question they answer differently
When a duty is set down because it is painful, what exactly is lost, and is the loss located in the stepping-back itself or in the reasoning that excuses it?
The traditional commentators
Advaita Vedāntasee this school across the GītāŚaṅkara, Madhusūdana
The renunciation is a counterfeit that forfeits the fruit of knowledge; only a sattvic giving-up, still to come in the next verse, truly delivers freedom.
Read against the triad of tamasic, rajasic, and sattvic tyaga this passage lays out.
Viśiṣṭādvaitasee this school across the GītāRāmānuja
The deeper error is doctrinal: reasoning that knowledge alone should be pursued because toil is painful, and forgetting that the mind's serenity comes only by the Lord's grace, never by effort alone.
Read as a misreading of how action serves liberation in ordered succession.
Viśiṣṭādvaita, in their fuller words

Ramanuja reads the failure as a misreading of scripture rather than a simple dislike of hardship: seeing that action toward liberation requires painful toil, the person concludes he should pursue knowledge alone, and abandons his ordained duties on that mistaken doctrine. He adds a claim of his own, that the mind's serenity comes only through the Lord's grace, never through toil by itself, so the renouncer misunderstands not only his duty but how liberation actually arrives.

Rāmānuja
Asked in question 5, below
Dvaitasee this school across the GītāMadhva
No verse-specific answer survives; Madhva's extant work offers no comment on 18.8, and this entry does not manufacture one.
An honest gap in the source record, not a position to be filled in.
Dvaita, in their fuller words

No comment by Madhva on this verse survives in the source record. Rather than supply an invented Dvaita reading, this entry stays with that absence; only Madhva's general, independently attested view that the self's capacity to act and renounce is delegated by the Lord, never autonomous, can be noted as background, without claiming it as his stated word on 18.8.

Madhva
Śuddhādvaitasee this school across the Gītā
No acarya from this school is on this verse's roster; see Shaiva below for the analogous honesty about a thin source.
Not authored for this verse; the roster here is Advaita, Vishishtadvaita, and Bhakti through Sridhara instead.
BhaktiŚrīdhara
The renunciation is an evil counterfeit of real letting-go, since the root failure is not knowing the self is no doer; only the dawn of Self-knowledge is renunciation in truth.
For one capable of the duty, who knows it is his, yet flees at the first discomfort.
Bhakti, in their fuller words

Sridhara gives the fullest and most vivid reading among the available sources: the root failure is not knowing that the self is no doer, and the renunciation that results is an evil counterfeit of real letting-go, no truer than an accidental fall into water is a holy immersion. Only the dawn of Self-knowledge, which he says swallows all action and ignorance as morning light swallows the stars, is real renunciation, and only that bears fruit.

Śrīdhara
Modern voices teachers of the last two centuries, read together; they stand apart from the classical schools
A modern readingMadhusūdana
Test your own retreats by this line: the question is never whether a task is hard, but whether it is set down because it is genuinely not yours, or only because it is uncomfortable.
Read as a practical, self-examinable warning rather than a doctrinal claim.
A modern reading, in their fuller words

Read against the compactness of Madhusudana's own comment, a modern-facing gloss stresses the verse's practical, testable edge: it names a motive rather than an activity, so the honest question for any seeker is never whether a task is hard, but whether it is set down because it is genuinely not one's duty, or only because it is uncomfortable.

Madhusūdana
Sit with these

A few questions to carry

These ask for understanding, not recall; each answer is settled by the commentary itself.

1
What, according to this verse, marks a renunciation as rajasic?
2
What does this rajasic renunciation fail to deliver?
3
Why is this renunciation called rajasic rather than tamasic, the kind described in the previous verse?
4
If a task genuinely harms your body, does stepping back from it always count as this verse's failure?
5
How does Ramanuja frame the specific error of the rajasic renouncer?
6
What is the practical test this verse leaves a seeker with?
For a second sitting6 more questions
7
What does the available source record say about Madhva's comment on this verse?
8
How does Abhinavagupta's surviving commentary relate to this specific verse?
9
What image does Sridhara use to describe the fear-driven renunciation this verse names?
10
According to Sridhara, what is the deeper root of the failure described here?
11
How does Madhusudana's own surviving comment on this verse compare in length and elaboration to the others authored here?
12
Where does this verse fall in the sequence of the three kinds of tyaga Krishna describes?

Carry this with youwhat stays

The next time you set a duty down, pause before you name it renunciation. Ask plainly: am I stepping back because this truly is not mine to carry, or only because it is hard on the body right now? Let the honest answer, not the relief of stopping, decide what you call it.

The next time you set a duty down, ask plainly why. If the whole reason is that it is hard on the body, you have not yet let it go; you have only stepped back from the strain.

दुःखमित्येव यत्कर्म कायक्लेशभयात्त्यजेत्।duḥkham ity eva yat karma kāya-kleśha-bhayāt tyajet

Read deeper

Everything a full study holds, folded below.

Word by word18 terms
duḥkhamtroublesomeitiasevaindeedyatwhichkarmadutieskāyabodilykleśhadiscomfortbhayātout of feartyajetgiving upsaḥtheykṛitvāhaving donerājasamin the mode of passiontyāgamrenunciation of desires for enjoying the fruits of actionsnaneverevacertainlytyāgarenunciation of desires for enjoying the fruits of actionsphalamresultlabhetattain
All the commentary, woven togetherevery voice, in one place

The commentary, woven together

machine-assisted draft, pending review

Convergence

his verse names the second, middling kind of renunciation, rajasic tyaga, coming right after the tamasic giving-up of the verse before it. The mark of it is simple: a person drops a duty only because it is painful, out of fear of the strain it will put on the body.

Śaṅkarācārya · Rāmānujācārya · Śrīdhara Svāmī · Madhusūdana Sarasvatī

The renunciation is classed as rajasic because its very cause is rajas. Pain, and the restless aversion to discomfort, are themselves qualities of rajas, so the giving-up born from them takes on that same coloring, whatever the actual content of the duty being dropped.

Śaṅkarācārya · Rāmānujācārya · Śrīdhara Svāmī · Madhusūdana Sarasvatī

What is renounced here is not some private indulgence but obligatory work, the duty one is actually meant to be doing. Setting that duty down merely to spare the body its discomfort is precisely what makes the renunciation go wrong.

Śaṅkarācārya · Śrīdhara Svāmī · Madhusūdana Sarasvatī

The consequence is stated without softening: such a person gains no fruit of renunciation at all. The outward appearance of letting go is present, but whatever renunciation was supposed to ripen into never arrives, because the duty was abandoned for the wrong reason.

Śaṅkarācārya · Rāmānujācārya · Śrīdhara Svāmī

This is not the same failure as the tamasic renunciation named just before it. There, the person never even recognizes the work as a duty. Here, at least on Sridhara's reading, the person may know quite clearly that the duty is his and that he is capable of it, yet he still lets the body's comfort outweigh that knowledge.

Śrīdhara Svāmī · Madhusūdana Sarasvatī

Divergence

Advaita Vedānta

Shankara and Madhusudana both hold that the fruit forfeited here is liberation itself, reached through a genuine standing in knowledge once action is truly laid down. Their comments stay close to the verse's own words: Shankara frames the failure as a false renunciation set against the coming sattvic one; Madhusudana's brief comment isolates bodily fear as the precise, sufficient cause of the rajasic classification, without extending far beyond the verse's plain sense.

Śaṅkarācārya · Madhusūdana Sarasvatī

Viśiṣṭādvaita

Ramanuja reads the failure as a misreading of scripture rather than a simple dislike of hardship: seeing that action toward liberation requires painful toil, the person concludes he should pursue knowledge alone, and abandons his ordained duties on that mistaken doctrine. He adds a claim of his own, that the mind's serenity comes only through the Lord's grace, never through toil by itself, so the renouncer misunderstands not only his duty but how liberation actually arrives.

Rāmānujācārya

Dvaita

No comment by Madhva on this verse survives in the source record. Rather than supply an invented Dvaita reading, this entry stays with that absence; only Madhva's general, independently attested view that the self's capacity to act and renounce is delegated by the Lord, never autonomous, can be noted as background, without claiming it as his stated word on 18.8.

Madhvācārya

Kashmir Śaiva

Abhinavagupta has no comment addressed to 18.8 specifically; his surviving remarks treat verses 18.4 through 18.11 as one continuous passage at 18.4. There he does say that renunciation takes the color of whichever guna moves it, so a rajasic or tamasic giving-up yields no fruit, while the sattvic renouncer's even-minded giving-up alone bears fruit. A Kashmir-Saiva extension of this to bodily fear specifically is offered here only as a flagged, conditional reading, not as his stated word on this verse.

Ācārya Abhinavagupta

Bhakti

Sridhara gives the fullest and most vivid reading among the available sources: the root failure is not knowing that the self is no doer, and the renunciation that results is an evil counterfeit of real letting-go, no truer than an accidental fall into water is a holy immersion. Only the dawn of Self-knowledge, which he says swallows all action and ignorance as morning light swallows the stars, is real renunciation, and only that bears fruit.

Śrīdhara Svāmī

Modern

Read against the compactness of Madhusudana's own comment, a modern-facing gloss stresses the verse's practical, testable edge: it names a motive rather than an activity, so the honest question for any seeker is never whether a task is hard, but whether it is set down because it is genuinely not one's duty, or only because it is uncomfortable.

Madhusūdana Sarasvatī

A Seeker Asks

If a task genuinely exhausts or even harms my body, is stepping back from it always this rajasic failure, or is there room for honest, sensible rest?

The verse targets a motive, not the fact of bodily strain. Shankara and Madhusudana both describe someone who judges the work as nothing but trouble and drops it purely from fear; a person who takes a genuinely needed rest while still holding the duty as his own is not described by this verse at all.

Śaṅkarācārya · Madhusūdana Sarasvatī

Sridhara's own image sharpens the line: he describes someone capable of the work, who knows it is his, beginning it, and then fleeing at the first discomfort as though dropping something scalding. The failure is in the fleeing under fear, not in feeling the difficulty honestly in the first place.

Śrīdhara Svāmī

Ramanuja's reading adds a further test: watch whether you have built a doctrine to justify the retreat, telling yourself that avoiding the hardship is itself a wiser path. That self-justifying story, more than the rest itself, is what the verse calls rajasic.

Rāmānujācārya

Contemplation

The next time you set a duty down, pause before you name it renunciation. Ask plainly: am I stepping back because this truly is not mine to carry, or only because it is hard on the body right now? Let the honest answer, not the relief of stopping, decide what you call it.

Sit with this · sonnet-5-authored

All the translations and commentary7 translations
Translationsthe verse re-voiced; tap a translator
The commentatorsthe schools expound the verse

Pull up a chair.

You have come to sit with this verse. When you are ready to hear the translators and the commentators in full, open a tradition in the doorways below, or add a voice by name above.

Also hear this verse, tradition by tradition.

Where this teaching echoesin the Haripath