StudyVedanta
Skip to the verse
V.1011.911.11
Read slowly

The list keeps growing, and its refusal to be summed up in one heading is itself the point.

Many mouths, many eyes, many ornaments, many weapons raised high, the description simply keeps adding, and more than one commentator on file reads that overflow, not any single image within it, as what the verse actually wants seen.

10Chapter 11
The verseSpoken by Sanjaya
Voices6 commentators · 5 schools · modern voices
The readingAbout 5 minutes, unhurried
अनेकवक्त्रनयनमनेकाद्भुतदर्शनम्। अनेकदिव्याभरणं दिव्यानेकोद्यतायुधम्
aneka-vaktra-nayanam anekādbhuta-darśhanam aneka-divyābharaṇaṁ divyānekodyatāyudham

It had many faces and eyes, wonder upon wonder to behold, decked in many divine ornaments, and it held many divine weapons raised and ready.

Bhagavad Gita 11.10
0:00 / 0:00

Saved for this reading session

Three movements · tap a label to switch

Sanskrit recitation by Swami Brahmānanda

Audio from the Gītā Supersite, IIT Kanpur

The reading read whole, as one unhurried piece

Where it stands

You are still inside the vision Arjuna was given a moment ago. Nothing new begins here; the description simply continues, moving one step nearer to the same form, adding detail to detail rather than resolving them into a single picture.

The teaching

Not one shape but an overflow: many mouths, many eyes, ornaments and weapons past counting.

Notice how the verse works: it does not settle on one shape and describe it. It lists, and the list keeps growing. Many mouths and eyes, many wondrous and startling sights to take in, many divine ornaments, and many divine weapons held raised and ready. Where the commentators comment on this at all, they keep the items concrete rather than letting them blur into vague grandeur: actual ornaments, actual weapons, all at a scale beyond ordinary measure. And more than one source names, directly, what the whole catalogue is doing: the form cannot be told under any single heading. That is not a shortcoming of the description. It is the description's own point. Ramanuja goes further, reading the form's refusal to be bounded as the visible shape of something already true, that the Lord upholds the whole world, past, present, and future, from within, and that this vision simply opens that constant governance to sight. It is worth being honest, too, about where the record thins out. Madhva's comment here is folded into the previous verse and speaks only to a name, not to this catalogue. Abhinavagupta's compressed digest says nothing at all at this line. Madhusudana offers little more than the verse's own words repeated back. That unevenness is part of what an honest reading owes you: not every verse draws equal attention from every school, and a line can still matter to the chapter while receiving very little individual comment.

The doubt that rises

If even the commentators who wrote whole systems around this text have little to add here beyond confirming the list, what is actually being asked of you as a reader: to interpret, or simply to stay with something that will not resolve into an interpretation?

Where the paths divide

Advaita Vedanta

Read from Shankara's brief, confirming comment.

What survives is mostly confirmation: the catalogue as given, and a note that more description is still to come. Extending this in the direction of Shankara's wider teaching, such overwhelming multiplicity would be read as Ishvara's self-display through maya, real and majestic, but pitched at the level where form is still seen, not the formless Brahman beyond all appearance. That extension should be held as an extension, since the surviving comment here does not itself argue it.

Vishishtadvaita

Read from Ramanuja's fuller comment on boundlessness.

Ramanuja's comment reaches furthest among the classical sources at this verse. He reads the form as shining and endless, unbounded by any place or time because it is what upholds the whole world across all three times. The faces turned every way are, on this reading, the visible shape of a pervasion that was always quietly real, now simply opened to Arjuna's sight.

Dvaita

Read honestly as an absence, with any extension flagged.

No independent comment from Madhva survives at this line; his remark is folded into the previous verse and addresses only the name Hari there. Offered strictly as a conditional extension of his wider system, and not his stated words: such multiplicity might be read as a display entirely within the Lord's own independent power, consistent with his theme that only the Lord is fully autonomous and every self remains dependent.

Kashmir Shaivism

Read honestly as silence, with any extension clearly flagged.

No comment from Abhinavagupta survives at this verse; his compressed digest passes over this descriptive line entirely. Offered explicitly as a conditional extrapolation and not his stated view: on a Kashmir Shaiva reading elsewhere in his work, such overflowing multiplicity would be treated as consciousness's own self-aware pulse displaying its inexhaustible fullness to itself, the many faces read as one awareness recognizing itself everywhere.

Bhakti

Read from Sridhara's naming of the catalogue's own point.

Sridhara treats the whole list as answering a single implicit question, what was the form like, and states its real point directly rather than lingering on any one item: the form cannot be told under any single heading. Its very resistance to summary is, for him, the substance of what is being shown, not an incidental difficulty in the telling.

Modern

Read from Madhusudana's bare restatement.

Madhusudana's surviving comment here is little more than the verse's own words repeated back, with no further gloss recorded. Read plainly, this suggests he judged the catalogue self-sufficient, needing no interpretive addition of its own at this particular line; anything more would have to be drawn from elsewhere in his commentary, not from this verse.

The classical comments at this verse are, for the most part, brief, confirmatory, or in Abhinavagupta's case entirely absent. Only Ramanuja reaches for a fuller claim. That unevenness is left open rather than smoothed over: a verse built almost entirely of description can still matter to the chapter's structure while drawing very little individual argument from a given school, and it is more faithful to say so than to manufacture a doctrine where none survives.

A question to carry

When a description this thick refuses to resolve into any one image, what are you willing to simply hold as overflow, rather than reduce to something you can summarize and move past?

Let the list stay a list. Do not rush it toward a single picture; let many mouths, many eyes, many ornaments, and many weapons raised high be exactly as much as they are, more than any one heading can hold, and rest for a moment in that excess rather than resolving it.

Each school is voiced from the commentators named above. Their full words, every translation, and where the schools agree and differ wait in the reading desk just below. Open the commentary desk.

The catalogue begun in the previous verse continues here, one item folded onto the last, still building toward the fuller claim, a few verses on, that this form is infinite and faces every direction at once.

Where they agreethe convergence

Where the sources comment at all, they agree on this much: the form will not resolve into one clean picture, and that resistance to summary is not a gap in the description but part of what it is showing.

Across schools and centuries the commentators come to the same ground. These are the points they share, and the voices that hold each one.

3schools

The catalogue continues directly from the verse before it: many mouths and eyes, many wondrous sights, many divine ornaments, many divine weapons raised and ready.

Across Advaita, Viśiṣṭādvaita, BhaktiŚaṅkara · Rāmānuja · Śrīdhara · Madhusūdana
In Śaṅkara, Rāmānuja, and 2 others’ words

Every source that comments substantively agrees this verse continues, rather than begins, the description of the cosmic form: many mouths and eyes, many wondrous sights, many divine ornaments, many divine weapons held raised and ready. The commentators that address the list at all read it as one flowing catalogue, each item simply added to the last, so that the form is felt to overflow in every direction rather than being fixed to any single shape.

Asked in question 1, below
2schools

The ornaments and weapons named are treated as concrete, actual items at divine scale, keeping the form from dissolving into vague abstraction even as it multiplies.

Across Advaita, BhaktiŚaṅkara · Śrīdhara
In Śaṅkara and Śrīdhara’s words

Where the sources go beyond bare paraphrase, they treat the ornaments and weapons as concrete rather than vague: actual necklaces and armlets, actual weapons raised high, all at a scale beyond the ordinary. The point of naming them so plainly is not decoration; it is to keep the form from dissolving into abstraction even as it multiplies past counting.

3schools

Ramanuja reads the form's lack of edge as the visible sign of a pervasion that was always real: the Lord upholding the whole world across all three times from within.

Across Dvaita, Kashmir Śaiva, AdvaitaMadhva · Abhinavagupta · Madhusūdana
In Madhva, Abhinavagupta, and 1 others’ words

More than one source on file is honest that the record here is thin. Madhva's comment is folded into the previous verse and does not itself address this catalogue; Abhinavagupta's compressed digest is silent; Madhusudana offers only a bare restatement. This thinness is itself worth registering rather than smoothing over: not every verse receives equal attention from every school, and a verse can still matter to the chapter's structure while drawing very little individual comment.

1school

Sridhara names the catalogue's real point directly: the form cannot be told under any single heading, and that refusal of summary is itself the teaching.

Across ViśiṣṭādvaitaRāmānuja
In Rāmānuja’s words

Where fuller comment survives, it reaches past the list toward a single claim: the form is without edge, it cannot be held within any place or time, and it looks and faces every quarter at once. This is read as pointing forward to the form's explicit description a few verses on as infinite and facing every direction, so the present catalogue is already preparing the reader for that larger claim.

3schools

Where the record is thin or silent, as with Madhva, Abhinavagupta, and Madhusudana at this particular line, that thinness is reported honestly rather than filled in with invented doctrine.

Across Advaita, Viśiṣṭādvaita, BhaktiŚaṅkara · Rāmānuja · Śrīdhara
In Śaṅkara, Rāmānuja, and 1 others’ words

Underneath the surface variation of how much each source says lies one shared judgment: the very refusal of the form to be told under a single heading is itself part of the teaching. Whether a source elaborates that point at length or barely touches it, none of the extant comments treat the multiplicity as incidental description to be passed over quickly for its own sake.

This is the shared ground; it can be carried as it is. Below is where they differ.

Where they differthe divergence

The question they answer differently
Given how briefly, or in one case not at all, several classical acaryas comment on this catalogue, the live question is less a doctrinal dispute within the verse and more how much can honestly be drawn from a description whose interpretive record is this uneven.
The traditional commentators
Advaita Vedāntasee this school across the GītāŚaṅkara
Shankara's own comment confirms the catalogue and marks continuity with the prior verse; a maya-conditioned reading of the display is a reasonable but flagged extension of his wider system, not this verse's stated argument.
Where the surviving comment is brief and mostly confirmatory.
Viśiṣṭādvaitasee this school across the GītāRāmānuja
Ramanuja reads the form's boundlessness as the visible shape of the Lord's constant inner pervasion, faces turned every way because he already upholds the world across all three times.
The fullest classical comment on file, reaching past the list toward a single claim.
Viśiṣṭādvaita, in their fuller words

Ramanuja's comment is the fullest classical reading on file at this verse, and it treats the form's boundlessness as the visible sign of the Lord's inner pervasion: because he already upholds the entire world across all three times from within, the form that shows him cannot be confined to any one place or moment. The faces turned every way are not ornamental detail but the spatial expression of a governance that was always real, now simply opened to sight.

Rāmānuja
Asked in question 3, below
Dvaitasee this school across the GītāMadhva
No independent comment survives at this verse; Madhva's remark is folded into 11.9 and concerns only the name Hari, so any reading of this catalogue in his name must be a flagged extension.
Held as an honest absence rather than filled in.
Dvaita, in their fuller words

No independent comment from Madhva survives at this verse; his remark is folded into 11.9 and addresses only the name Hari there, not this verse's catalogue. Extending his broader system conditionally, such multiplicity would likely be read as a display entirely within the Lord's own independent power, granted to no one else, consistent with his governing theme that only the Lord is fully autonomous. This is offered strictly as a flagged extension, not as Madhva's stated words on this line.

Madhva
Kashmir Śaivasee this school across the GītāAbhinavagupta
No comment survives from Abhinavagupta here; any reading of the many faces as consciousness recognizing its own fullness is a flagged conditional extension, not his stated words.
Held as an honest silence, with extrapolation clearly marked as such.
BhaktiŚrīdhara
Sridhara names the catalogue's own point directly: the form cannot be told under any single heading, and that refusal of summary is itself the teaching.
Focused on why the list resists being reduced to one image.
Bhakti, in their fuller words

Sridhara reads the entire catalogue as answering one implicit question, what was the form like, and names its real point directly: the form cannot be told under any single heading. He does not linger on any one item in the list, treating the very impossibility of summary as the substance of what is being shown, rather than a difficulty the description merely happens to run into.

Śrīdhara
Asked in question 2, below
Modern voices teachers of the last two centuries, read together; they stand apart from the classical schools
A modern readingMadhusūdana
Madhusudana's surviving comment is a bare restatement with no added gloss, suggesting the catalogue was judged self-sufficient rather than in need of interpretive elaboration at this line.
Read for what the comment itself declines to add.
A modern reading, in their fuller words

Madhusudana's surviving comment here is a bare restatement of the verse's own words, with no further gloss recorded. Read plainly and without over-claiming, this suggests he judged the catalogue self-sufficient, needing no interpretive addition of its own; a fuller reading of what such multiplicity might mean for the seer's transformed eye would have to come from elsewhere in his commentary, not from this line.

Madhusūdana
Sit with these

A few questions to carry

These ask for understanding, not recall; each answer is settled by the commentary itself.

1
What four things does this verse's catalogue name in sequence?
2
According to Sridhara, what is the real point of a catalogue this long and varied?
3
What does Ramanuja's fuller comment say the form's boundlessness expresses?
4
Why do several acaryas' comments on this verse stay so brief or, in one case, absent altogether?
5
What is the honest way to handle a verse where a source, such as Madhva or Abhinavagupta, offers no independent comment?
For a second sitting7 more questions
6
What does this verse indicate about how it relates to the verse just before it?
7
What does Shankara's brief comment mainly add beyond confirming the catalogue?
8
Where is Madhva's actual comment relevant to this verse located?
9
What would a Kashmir Shaiva extension of this verse suggest about the many faces and eyes, if offered conditionally?
10
What is distinctive about Madhusudana's surviving comment at this verse?
11
What do the sources that comment on the ornaments and weapons stress about them?
12
Why does this page treat the uneven length of the six commentaries as worth noting rather than hiding?

Carry this with youwhat stays

Let the list itself be the practice for a moment. Do not rush past 'many mouths, many eyes, many ornaments, many weapons' to reach some tidier summary underneath it. Stay with the plain accumulation, one wonder added to the last, until you feel what several of the sources notice directly: that the form refuses to be told under any single heading, and that this refusal is not a failure of description but part of what is being shown.

Let the list overflow rather than resolve; some things are rightly known only as more than any single word can hold, and this form is one of them.

अनेकवक्त्रनयनमनेकाद्भुतदर्शनम्। अनेकदिव्याभरणं दिव्यानेकोद्यतायुधम्॥aneka-vaktra-nayanam aneka-adbhuta-darśanam, aneka-divya-ābharaṇaṁ divya-aneka-udyata-āyudham

Read deeper

Everything a full study holds, folded below.

Word by word13 terms
anekamanyvaktrafacesnayanameyesanekamanyadbhutawonderfuldarśhanamhad a vision ofanekamanydivyadivineābharaṇamornamentsdivyadivineanekamanyudyataupliftedāyudhamweapons
All the commentary, woven togetherevery voice, in one place

The commentary, woven together

machine-assisted draft, pending review

Convergence

very source that comments substantively agrees this verse continues, rather than begins, the description of the cosmic form: many mouths and eyes, many wondrous sights, many divine ornaments, many divine weapons held raised and ready. The commentators that address the list at all read it as one flowing catalogue, each item simply added to the last, so that the form is felt to overflow in every direction rather than being fixed to any single shape.

Śaṅkarācārya · Rāmānujācārya · Śrīdhara Svāmī · Madhusūdana Sarasvatī

Where the sources go beyond bare paraphrase, they treat the ornaments and weapons as concrete rather than vague: actual necklaces and armlets, actual weapons raised high, all at a scale beyond the ordinary. The point of naming them so plainly is not decoration; it is to keep the form from dissolving into abstraction even as it multiplies past counting.

Śaṅkarācārya · Śrīdhara Svāmī

More than one source on file is honest that the record here is thin. Madhva's comment is folded into the previous verse and does not itself address this catalogue; Abhinavagupta's compressed digest is silent; Madhusudana offers only a bare restatement. This thinness is itself worth registering rather than smoothing over: not every verse receives equal attention from every school, and a verse can still matter to the chapter's structure while drawing very little individual comment.

Madhvācārya · Ācārya Abhinavagupta · Madhusūdana Sarasvatī

Where fuller comment survives, it reaches past the list toward a single claim: the form is without edge, it cannot be held within any place or time, and it looks and faces every quarter at once. This is read as pointing forward to the form's explicit description a few verses on as infinite and facing every direction, so the present catalogue is already preparing the reader for that larger claim.

Rāmānujācārya

Underneath the surface variation of how much each source says lies one shared judgment: the very refusal of the form to be told under a single heading is itself part of the teaching. Whether a source elaborates that point at length or barely touches it, none of the extant comments treat the multiplicity as incidental description to be passed over quickly for its own sake.

Śaṅkarācārya · Rāmānujācārya · Śrīdhara Svāmī

Divergence

Advaita Vedānta

Shankara's own comment stays at the level of confirming the catalogue and noting continuity with the previous verse; it does not, here, unfold a doctrine of maya or Ishvara. Extending this conditionally in line with his wider system, the form's overwhelming multiplicity would be read as Ishvara's self-display through maya, real and majestic, but pitched at the level where form is still seen, not the formless Brahman that admits no appearance whatsoever. This extension is flagged as an extrapolation rather than the verse's own stated argument.

Śaṅkarācārya

Viśiṣṭādvaita

Ramanuja's comment is the fullest classical reading on file at this verse, and it treats the form's boundlessness as the visible sign of the Lord's inner pervasion: because he already upholds the entire world across all three times from within, the form that shows him cannot be confined to any one place or moment. The faces turned every way are not ornamental detail but the spatial expression of a governance that was always real, now simply opened to sight.

Rāmānujācārya

Dvaita

No independent comment from Madhva survives at this verse; his remark is folded into 11.9 and addresses only the name Hari there, not this verse's catalogue. Extending his broader system conditionally, such multiplicity would likely be read as a display entirely within the Lord's own independent power, granted to no one else, consistent with his governing theme that only the Lord is fully autonomous. This is offered strictly as a flagged extension, not as Madhva's stated words on this line.

Madhvācārya

Kashmir Śaiva

There is no surviving comment from Abhinavagupta at this verse; his compressed digest passes over this descriptive line entirely. Offered explicitly as a conditional extension and not his stated view: on a Kashmir Shaiva reading elsewhere in his work, such overflowing multiplicity would be treated as consciousness's own self-aware pulse displaying its inexhaustible fullness to itself, the many faces read as one awareness recognizing itself everywhere rather than as separate parts.

Ācārya Abhinavagupta

Bhakti

Sridhara reads the entire catalogue as answering one implicit question, what was the form like, and names its real point directly: the form cannot be told under any single heading. He does not linger on any one item in the list, treating the very impossibility of summary as the substance of what is being shown, rather than a difficulty the description merely happens to run into.

Śrīdhara Svāmī

Modern

Madhusudana's surviving comment here is a bare restatement of the verse's own words, with no further gloss recorded. Read plainly and without over-claiming, this suggests he judged the catalogue self-sufficient, needing no interpretive addition of its own; a fuller reading of what such multiplicity might mean for the seer's transformed eye would have to come from elsewhere in his commentary, not from this line.

Madhusūdana Sarasvatī

A Seeker Asks

Several of these commentators say very little here, and one says nothing at all. Is there really anything to learn from a verse this thin on the interpretive record?

Yes, though what there is to learn is different from what a richly argued verse offers. Where Shankara, Ramanuja, and Sridhara do comment, they converge on the same modest but real point: the catalogue is deliberate, and its refusal to be summarized under one heading is itself part of the teaching, not incidental detail.

Śaṅkarācārya · Śrīdhara Svāmī

Ramanuja's fuller comment shows that even a mostly descriptive verse can carry real doctrinal weight, since he reads the form's boundlessness here as pointing forward to the Lord's explicit inner pervasion, stated openly only a few verses later.

Rāmānujācārya

And where the record is genuinely thin, as with Madhva's absent independent comment, Abhinavagupta's silence, and Madhusudana's bare paraphrase, the honest response is to say so plainly rather than invent a fuller commentary in their names. That honesty is itself part of what a faithful reading owes the sources.

Madhvācārya · Ācārya Abhinavagupta · Madhusūdana Sarasvatī

Contemplation

Let the list itself be the practice for a moment. Do not rush past 'many mouths, many eyes, many ornaments, many weapons' to reach some tidier summary underneath it. Stay with the plain accumulation, one wonder added to the last, until you feel what several of the sources notice directly: that the form refuses to be told under any single heading, and that this refusal is not a failure of description but part of what is being shown.

Sit with this · sonnet-5-authored

All the translations and commentary7 translations
Translationsthe verse re-voiced; tap a translator
The commentatorsthe schools expound the verse

Pull up a chair.

You have come to sit with this verse. When you are ready to hear the translators and the commentators in full, open a tradition in the doorways below, or add a voice by name above.

Also hear this verse, tradition by tradition.

Where this teaching echoesin the Haripath